PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G29920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 349aa    MW: 37018.1 Da    PI: 5.9059
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G29920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.4e-082873192254
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      ++yp+ +e+  LA  +gL+ +q+++WF N R +
  OGLUM03G29920.1 287 HPYPNDNEKLMLAVATGLSRSQISNWFINARVR 319
                      89*****************************88 PP

2BELL60.73.4e-201412031072
             BELL  10 akLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      akLlsll e++ r+++y  +l+ v +sFe + g g+ + Yt+l  +a+SrhF +L+ ai  ++
  OGLUM03G29920.1 141 AKLLSLLSELESRHEHYFGELRRVSASFEPALGAGATAGYTALMAQAMSRHFGSLRRAILRKL 203
                      8**********************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-1781201IPR006563POX domain
PfamPF075263.2E-2187199IPR006563POX domain
PROSITE profilePS5007111.175260323IPR001356Homeobox domain
CDDcd000863.97E-11263324No hitNo description
SMARTSM003897.4E-9263327IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-26268329IPR009057Homeodomain-like
SuperFamilySSF466898.98E-17269331IPR009057Homeodomain-like
PfamPF059204.0E-17280319IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MVASKQLHSQ RCGGHYCQLH HHRPEEIAGA GAESHRRDGS SGCGGAGPMV VLTLGSGAAA  60
AEDDGGGRSR CCCGAGGAAP ATMVSALRGS RYLLPAQELL REAVSAAAAS ARGGDDDDEA  120
VASFPHDGKS TGIGGGGGVQ AKLLSLLSEL ESRHEHYFGE LRRVSASFEP ALGAGATAGY  180
TALMAQAMSR HFGSLRRAIL RKLRLHAAAA ARTRSALLRL ARDAMEEDDE GDGEEEEEEE  240
EDVVNRVVRR TKQAAAARAE QAWRPLRGLP EDAVGVLRAW LFDHFLHPYP NDNEKLMLAV  300
ATGLSRSQIS NWFINARVRL WKPMVEEMYN DEFDDDDAGS GGGGASSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16269327563Homeobox protein Meis2
3k2a_B1e-16269327563Homeobox protein Meis2
4xrm_A1e-16269327563Homeobox protein Meis2
4xrm_B1e-16269327563Homeobox protein Meis2
5bng_A1e-16269327159Homeobox protein Meis2
5bng_B1e-16269327159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0646650.0AK064665.1 Oryza sativa Japonica Group cDNA clone:002-115-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629617.11e-142PREDICTED: BEL1-like homeodomain protein 11
TrEMBLA0A0D9ZBM70.0A0A0D9ZBM7_9ORYZ; Uncharacterized protein
STRINGORGLA03G0273800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.16e-35BEL1-like homeodomain 11